{"product_id":"proteintech-85939-4-rr","title":"Proteintech, 85939-4-RR, NUMB Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NUMB (85939-4-RR) by Proteintech is a Recombinant antibody targeting NUMB in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n85939-4-RR targets NUMB in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, A-204 cells,  NIH\/3T3 cells,  mouse brain tissue,  rat brain tissue,  SKOV-3 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNUMB, also named as S171, plays a role in the determination of cell fates during development. It is a membrane-bound protein that has been shown to associate with EPS15, LNX1, and NOTCH1. The degradation of NUMB is induced in a proteasome-dependent manner by MDM2. Four transcript variants encoding different isoforms have been found for this gene.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag31553 Product name: Recombinant human NUMB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 510-651 aa of NM_001005743 Sequence: SYPVANGMPYPAPNVPVVGITPSQMVANVFGTAGHPQAAHPHQSPSLVRQQTFPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASADRHTEVPTGTCPVDPFEAQWAALENKSKQRTNPSPTNPFSSDLQKTFEIEL Predict reactive species\nFull Name: numb homolog (Drosophila)\nCalculated Molecular Weight: 71KD\nObserved Molecular Weight: 66-71 kDa\nGenBank Accession Number: NM_001005743\nGene Symbol: NUMB\nGene ID (NCBI): 8650\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P49757\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888437874857,"sku":"85939-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-85939-4-rr","provider":"Iright","version":"1.0","type":"link"}