{"product_id":"proteintech-85946-1-rr","title":"Proteintech, 85946-1-RR, DLX6 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe DLX6 (85946-1-RR) by Proteintech is a Recombinant antibody targeting DLX6 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n85946-1-RR targets DLX6 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: mouse embryo tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDistal-less homeobox 6 (DLX6) has been reported to play important roles in the development of craniofacial structures, inner ear, limb, and brain. DLX6 was significantly highly expressed in oral cancer tissues in The Cancer Genome Atlas database. DLX6 promotes cell proliferation and suppresses cell apoptosis in oral cancer cells. EGFR-CCND1 pathway might be the potential mechanism participating in the regulating axis (PMID: 33215805).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag19724 Product name: Recombinant human DLX6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 110-175 aa of BC069363 Sequence: QGSNPHESDPLQGSAALSPRSPALPPVWDVSASAKGVSMPPNSYMPGYSHWYSSPHQDTMQRPQMM Predict reactive species\nFull Name: distal-less homeobox 6\nCalculated Molecular Weight: 175 aa, 20 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC069363\nGene Symbol: DLX6\nGene ID (NCBI): 1750\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P56179\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888419786921,"sku":"85946-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-85946-1-rr","provider":"Iright","version":"1.0","type":"link"}