{"product_id":"proteintech-85949-1-rr","title":"Proteintech, 85949-1-RR, SNAPIN Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SNAPIN (85949-1-RR) by Proteintech is a Recombinant antibody targeting SNAPIN in WB, ELISA applications with reactivity to human samples\n85949-1-RR targets SNAPIN in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, A375 cells,  SKOV-3 cells,  DU 145 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSnapin, a protein of relative molecular weight of 15kd, is implicated in neurotransmission by binding to SNAP-25. Snapin was enriched in neurons and exclusively located on synaptic vesicle membrane, which may be a PKA target for modulating transmitter release through the cAMP-dependent signal-transduction pathway. This anitbody can recognize the 15-18kd(Monomer) and 30-36kd(Dimer) forms of SNAPIN.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0101 Product name: Recombinant human SNAPIN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-136 aa of BC000761 Sequence: MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK Predict reactive species\nFull Name: SNAP-associated protein\nCalculated Molecular Weight: 15 kDa\nObserved Molecular Weight: 15-18 kDa\nGenBank Accession Number: BC000761\nGene Symbol: SNAPIN\nGene ID (NCBI): 23557\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O95295\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888667513001,"sku":"85949-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-85949-1-rr","provider":"Iright","version":"1.0","type":"link"}