{"product_id":"proteintech-85982-1-rr","title":"Proteintech, 85982-1-RR, IFI30 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe IFI30 (85982-1-RR) by Proteintech is a Recombinant antibody targeting IFI30 in WB, ELISA applications with reactivity to human, rat samples\n85982-1-RR targets IFI30 in WB, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Daudi cells,  HL-60 cells,  Raji cells,  rat spleen tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIFI30(interferon, gamma-inducible protein 30) is also named as IP30, GILT, IFI-30, MGC32056, IFI30 and belongs to the GILT family. It can facilitate the processing and presentation to antigen-specific T cells of protein antigens containing disulfide bonds. IFI30 is inducibly up-regulated by IFN-g, as are MHC class II molecules, the associated invariant chain, and HLA-DM, which catalyses peptide loading in MIICs and the 35 kDa species is the IFI30 proform, and the 30-kDa species is the mature form(PMID:10639150). It can exsit as a dimer(PMID:17142755).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag2178 Product name: Recombinant human IFI30 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-260 aa of BC021136 Sequence: CSRHTFAPAAMTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKKPDVCPSSTSSLRSVCFK Predict reactive species\nFull Name: interferon, gamma-inducible protein 30\nCalculated Molecular Weight: 261 aa, 29 kDa\nObserved Molecular Weight: 30-35 kDa\nGenBank Accession Number: BC021136\nGene Symbol: IFI30\nGene ID (NCBI): 10437\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P13284\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888765882537,"sku":"85982-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-85982-1-rr","provider":"Iright","version":"1.0","type":"link"}