{"product_id":"proteintech-86027-1-rr","title":"Proteintech, 86027-1-RR, ESM1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ESM1 (86027-1-RR) by Proteintech is a Recombinant antibody targeting ESM1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n86027-1-RR targets ESM1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HUVEC cells, PC-3 cells,  DU 145 cells,  A2780 cells,  SKOV-3 cells,  mouse brain tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nESM1, also known as endocan or endothelial cell-specific molecule 1, is a protein-coding gene that encodes a secreted proteoglycan primarily expressed in endothelial cells of human tissues, including lung, kidney, and vascular systems. The protein consists of a 20 kDa core protein with a dermatan sulfate chain, forming a 50 kDa mature proteoglycan. ESM1 plays a crucial role in endothelial cell proliferation, migration, and angiogenesis (blood vessel formation). It modulates vascular development and maintains endothelial homeostasis. Overexpression of ESM1 is observed in cancers such as gastric, cervical, and lung tumors, where it promotes angiogenesis and tumor progression via pathways like VEGF\/ERK signaling. Elevated serum ESM1 levels are associated with poor clinical outcomes in cancer patients.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag3019 Product name: Recombinant human ESM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-184 aa of BC011989 Sequence: SNNYAVDCPQHCDSSECKSSPRCERTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR Predict reactive species\nFull Name: endothelial cell-specific molecule 1\nCalculated Molecular Weight: 184 aa, 20 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC011989\nGene Symbol: ESM1\nGene ID (NCBI): 11082\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NQ30\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888742584489,"sku":"86027-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86027-1-rr","provider":"Iright","version":"1.0","type":"link"}