{"product_id":"proteintech-86101-2-rr","title":"Proteintech, 86101-2-RR, GMIP Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GMIP (86101-2-RR) by Proteintech is a Recombinant antibody targeting GMIP in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n86101-2-RR targets GMIP in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGMIP (Gem-interacting protein) is a 970 amino acid protein that stimulates the GTPase activity of RhoA in vitro and in vivo. GMIP interacts with Gem through its N-terminus and has a Rho GTPase-activating protein domain at its C-terminus. The Rho family of GTP-binding proteins plays a role in the development of neuronal structure. GMIP is able to inhibit RhoA function, leading to Actin cytoskeletal reorganization in vivo.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag23239 Product name: Recombinant human GMIP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC126436 Sequence: MDAAEPGLPPGPEGRKRYSDIFRSLDNLEISLGNVTLEMLAGDPLLSEDPEPDKTPTATVTNEASCWSGPSPEGPVPLTGEELDLRLIRTK Predict reactive species\nFull Name: GEM interacting protein\nObserved Molecular Weight: 130 kDa\nGenBank Accession Number: BC126436\nGene Symbol: GMIP\nGene ID (NCBI): 51291\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9P107\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888756904105,"sku":"86101-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86101-2-rr","provider":"Iright","version":"1.0","type":"link"}