{"product_id":"proteintech-86106-1-rr","title":"Proteintech, 86106-1-RR, SHH Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SHH (86106-1-RR) by Proteintech is a Recombinant antibody targeting SHH in WB, ELISA applications with reactivity to human, mouse, rat samples\n86106-1-RR targets SHH in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, rat liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSHH, also named as HHG-1, belongs to the hedgehog family. SHH binds to the patched (PTC) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes. In the absence of SHH, PTC represses the constitutive signaling activity of SMO. It regulates another target, the gli oncogene. The Shh protein is synthesized as a 45-kDa precursor that undergoes an autocatalytic processing event that produces a 19-kDa N-terminal product, responsible for all signaling activities, and a 25-kDa C-terminal fragment (PMID:10753901, PMID: 16282375). SHH can be detected precursor protein as 48-51-kDa polypeptides (PMID: 15292211).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg4010 Product name: recombinant human SHH protein Source: mammalian cells -derived, pHZ-KIsec-C-mFc Tag: C-mFc Domain: 24-197 aa of NM_000193 Sequence: CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG Predict reactive species\nFull Name: sonic hedgehog homolog (Drosophila)\nCalculated Molecular Weight: 50 kDa\nObserved Molecular Weight: 50-60 kDa\nGenBank Accession Number: NM_000193\nGene Symbol: SHH\nGene ID (NCBI): 6469\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q15465\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888821686441,"sku":"86106-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86106-1-rr","provider":"Iright","version":"1.0","type":"link"}