{"product_id":"proteintech-86114-3-rr","title":"Proteintech, 86114-3-RR, VISTA Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe VISTA (86114-3-RR) by Proteintech is a Recombinant antibody targeting VISTA in WB, IHC, ELISA applications with reactivity to mouse samples\n86114-3-RR targets VISTA in WB, IHC, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: bEnd.3 cells, mouse spleen tissue\nPositive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVISTA, also known as PD-1H, Dies1, and Gi24, is encoded by the Vsir gene in mice. VISTA is a type I transmembrane protein that acts as an immune-regulatory checkpoint on hematopoietic cells and shares homology with both the B7 family ligand PD-L1 and the CD28 family receptor PD-1. In mice, VISTA is expressed predominantly in hematopoietic tissues, such as the spleen, thymus, lymph node, and bone marrow (BM). VISTA plays a key role in regulating immune system responses and maintaining homeostasis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2809 Product name: Recombinant Mouse VISTA protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 33-191 aa of NM_001159572.1 Sequence: FKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAA Predict reactive species\nFull Name: RIKEN cDNA 4632428N05 gene\nCalculated Molecular Weight: 34 kDa\nObserved Molecular Weight: 40-55 kDa\nGenBank Accession Number: NM_001159572.1\nGene Symbol: 4632428N05Rik\nGene ID (NCBI): 74048\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9D659\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888841412777,"sku":"86114-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86114-3-rr","provider":"Iright","version":"1.0","type":"link"}