{"product_id":"proteintech-86151-1-rr","title":"Proteintech, 86151-1-RR, Cyclin A1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Cyclin A1 (86151-1-RR) by Proteintech is a Recombinant antibody targeting Cyclin A1 in WB, ELISA applications with reactivity to human, rat samples\n86151-1-RR targets Cyclin A1 in WB, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SKOV-3 cells, rat testis tissue,  human testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCNA1 belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. CCNA1 binds both CDK2 and CDC2 kinases, which give two distinct kinase activities, one appearing in S phase, the other in G2, and thus regulate separate functions in cell cycle. CCNA1 was found to bind to important cell cycle regulators, such as Rb family proteins, transcription factor E2F-1, and the p21 family proteins. In general, the expression of CCNA1 is tissue-specific and high CCNA1 expression is limited to testis; besides, lower levels of CCNA1 expression are also observed in other human cell lines and in healthy brain. Currently, CCNA1 expression has been illustrated to be downregulated in various tumors, including head and neck squamous-cell cancer (HNSCC) and nasopharyngeal carcinoma; and the promoter of the CCNA1 gene is found to be frequently methylated in colon cancer and HNSCC.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag4005 Product name: Recombinant human CCNA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 166-465 aa of BC036346 Sequence: GTLKSDLHFLLDFNTVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKYEEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIVPCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLLQ Predict reactive species\nFull Name: cyclin A1\nCalculated Molecular Weight: 464 aa, 52 kDa\nObserved Molecular Weight: 52-55 kDa\nGenBank Accession Number: BC036346\nGene Symbol: Cyclin A1\nGene ID (NCBI): 8900\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P78396\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888609415337,"sku":"86151-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86151-1-rr","provider":"Iright","version":"1.0","type":"link"}