{"product_id":"proteintech-86180-5-rr","title":"Proteintech, 86180-5-RR, CCR7 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CCR7 (86180-5-RR) by Proteintech is a Recombinant antibody targeting CCR7 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n86180-5-RR targets CCR7 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: T-47D cells, MCF-7 cells,  K-562 cells,  C6 cells\nPositive IF\/ICC detected in: K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC-C chemokine receptor type 7 (CCR7) , which belongs to the G-protein coupled receptor 1 family, is also a receptor for the MIP-3-beta chemokine, and probablely acts as mediator of EBV effects on B-lymphocytes or of normal lymphocyte functions. CCR7 is specially expressed in various lymphoid tissues and activated B- and T-lymphocytes, and can be strongly up-regulated in B-cells infected with Epstein-Barr virus and T-cells infected with herpesvirus 6 or 7.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2354 Product name: recombinant human CCR7 protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 25-59 aa of BC035343 Sequence: QDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAW Predict reactive species\nFull Name: chemokine (C-C motif) receptor 7\nCalculated Molecular Weight: 378 aa, 43 kDa\nObserved Molecular Weight: 40-43 kDa\nGenBank Accession Number: BC035343\nGene Symbol: CCR7\nGene ID (NCBI): 1236\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P32248\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888717516969,"sku":"86180-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86180-5-rr","provider":"Iright","version":"1.0","type":"link"}