{"product_id":"proteintech-86193-1-rr","title":"Proteintech, 86193-1-RR, ANGPTL3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ANGPTL3 (86193-1-RR) by Proteintech is a Recombinant antibody targeting ANGPTL3 in WB, IHC, IF-P, IF-Fro, ELISA applications with reactivity to human, mouse, rat samples\n86193-1-RR targets ANGPTL3 in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, A375 cells,  HEK-293 cells,  HuH-7 cells,  mouse liver tissue,  rat liver tissue\nPositive IHC detected in: human hepatocellular cancer, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse kidney tissue\nPositive IF-Fro detected in: mouse kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nANGPTL3 belongs to the angiopoietin-like protein family. ANGPTL3 is mainly synthesized by liver cells and is notably expressed in kidney podocytes.  Accumulating evidences have revealed that ANGPTL3 plays a critical role in both biological processes, such as lipid metabolism, angiogenesis and haematopoietic function and pathological changes, including atherosclerosis, carcinogenesis, nephrotic syndrome, diabetes, liver diseases and so on. Thus, ANGPTL3 may serve as a potential biomarker in these diseases.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag2573 Product name: Recombinant human ANGPTL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 241-460 aa of BC058287 Sequence: GIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE Predict reactive species\nFull Name: angiopoietin-like 3\nCalculated Molecular Weight: 460 aa, 54 kDa\nObserved Molecular Weight: 54 kDa\nGenBank Accession Number: BC058287\nGene Symbol: ANGPTL3\nGene ID (NCBI): 27329\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9Y5C1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888386887849,"sku":"86193-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86193-1-rr","provider":"Iright","version":"1.0","type":"link"}