{"product_id":"proteintech-86194-3-rr","title":"Proteintech, 86194-3-RR, OLR1\/LOX1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe OLR1\/LOX1 (86194-3-RR) by Proteintech is a Recombinant antibody targeting OLR1\/LOX1 in WB, ELISA applications with reactivity to human, mouse samples\n86194-3-RR targets OLR1\/LOX1 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue, bEnd.3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOLR1\/LOX-1 acts as a receptor, in the form of a homodimer, that mediates the recognition, internalization, and degradation of oxidatively modified low density lipoprotein (oxLDL) (PMID: 9052782, 15695803). ORL1 is predominantly expressed in endothelial cells and vascular-rich organs such as the placenta, lung, liver, and brain (PMID: 9828121). OLR1 is a protein containing 273 amino acids with a calculated molecular mass of 31 kDa but an apparent molecular mass of 50 kDa, which may result from the glycosylation of four potential N-linked glycosylation sites located at the C-terminal domain (PMID: 9052782).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2911 Product name: Recombinant Human OLR1\/LOX1 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 61-273 aa of NM_002543.3 Sequence: SQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ Predict reactive species\nFull Name: oxidized low density lipoprotein (lectin-like) receptor 1\nCalculated Molecular Weight: 31 kDa\nObserved Molecular Weight: 50-55 kDa\nGenBank Accession Number: NM_002543.3\nGene Symbol: OLR1\nGene ID (NCBI): 4973\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P78380-1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888793866409,"sku":"86194-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86194-3-rr","provider":"Iright","version":"1.0","type":"link"}