{"product_id":"proteintech-86196-3-rr","title":"Proteintech, 86196-3-RR, SCP2\/SCPx Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SCP2\/SCPx (86196-3-RR) by Proteintech is a Recombinant antibody targeting SCP2\/SCPx in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n86196-3-RR targets SCP2\/SCPx in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, HepG2 cells,  HEK-293 cells,  U-87 MG cells,  NIH\/3T3 cells,  rat brain tissue\nPositive IF\/ICC detected in: k562\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSCP2 (Sterol carrier protein-2), also called nonspecific lipid-transfer protein, is thought to play a major role in intracellular lipid transport and metabolism. Mutations of SCP2 have been associated with diseases involving abnormalities in lipid trafficking, such as Zellweger syndrome. The alternative splicing generates 58 kDa SCPx and 13-15 kDa SCP2 proteins, both of which contain a C-terninal SCP2 domain. In addition to the SCP2 domain, SCPx also contains an amino-terminal thiolase domain. The proteolytic cleavage of SCPx occurred when it was imported into peroxisomes, giving rise to a 44-46 kDa thiolase and a 13-15 kDa SCP2. It recognizes the intact 58 kDa SCPx protein as well as 44-46 kDa thiolase (PMID: 35996156).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag5895 Product name: Recombinant human SCPX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-322 aa of BC067108 Sequence: MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQIPYSAVDQACVGYVFGVAECVLALGFEKMSKGSLGIKFSDRTIPTDKHVDLLINKYGLSAHPVAPQMFGYAGKEHMEKYGTKIEHFAKIGWKNHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILASEAFVQKYGLQSKAVEILAQEMMTDLPSSFEEKSIIKMVGFDMSKEAARKCYEKSGLTPNDIDVIELHDCFSTNELLTYEALGLCPEGQGATLVDRGDNTYGGKWVINPSGGLISKGHPLGATGGHSCS Predict reactive species\nFull Name: sterol carrier protein 2\nCalculated Molecular Weight: 59 kDa\nObserved Molecular Weight: 46 kDa, 58 kDa\nGenBank Accession Number: BC067108\nGene Symbol: SCP2\nGene ID (NCBI): 6342\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P22307\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888819556521,"sku":"86196-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86196-3-rr","provider":"Iright","version":"1.0","type":"link"}