{"product_id":"proteintech-86213-1-rr","title":"Proteintech, 86213-1-RR, CD25\/IL-2RA Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CD25\/IL-2RA (86213-1-RR) by Proteintech is a Recombinant antibody targeting CD25\/IL-2RA in WB, ELISA applications with reactivity to mouse, rat samples\n86213-1-RR targets CD25\/IL-2RA in WB, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: CTLL-2 cells, Recombinant protein\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProliferation of T lymphocytes is triggered by the interaction of IL-2 with its specific receptor following T lymphocyte activation. The receptor for IL-2 has three forms, generated by different combinations of three different proteins, the alpha chain (IL-2R alpha), the beta chain (IL-2R beta), and the gamma chain (IL-2R gamma) (PMID: 8476561). IL-2R alpha (also known as CD25) is a type I transmembrane protein present on activated T cells, activated B cells, some thymocytes, myeloid precursors, and oligodendrocytes. CD25 is also found on natural CD4+ Foxp3+ Treg cells (PMID: 22585674).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1453 Product name: Recombinant Rat CD25\/IL-2R alpha protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-235 aa of NM_013163.1 Sequence: ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLNELVYMACLGNSWSNNCQCTSNSHDNSREQVTPQPEGQKEQQTTDTQKSTQSVYQENLAGHCREPPPWRHEDTKRIYHFVEGQIVLYTCIQGYKALQRGPAISICKTVCGEIRWTHPQLTCVDEKEHHQFLASEESQGSRNSFPESEASCPTPNTDFSQLTEATTTMETFVFTKEYQ Predict reactive species\nFull Name: interleukin 2 receptor, alpha\nCalculated Molecular Weight: 31kDa\nObserved Molecular Weight: 55-60 kDa\nGenBank Accession Number: NM_013163.1\nGene Symbol: Il2ra\nGene ID (NCBI): 25704\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P26897\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888720040105,"sku":"86213-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86213-1-rr","provider":"Iright","version":"1.0","type":"link"}