{"product_id":"proteintech-86224-2-rr","title":"Proteintech, 86224-2-RR, NEK1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NEK1 (86224-2-RR) by Proteintech is a Recombinant antibody targeting NEK1 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n86224-2-RR targets NEK1 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse testis tissue,  HEK-293T cells,  K-562 cells,  PC-12 cells,  rat testis tissue\nPositive IF\/ICC detected in: Starvation treated hTERT-RPE1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNEK1 (NIMA-Related Kinase 1) is a serine\/threonine-protein kinase that plays a multifaceted and critical role in cellular homeostasis. It is widely expressed and involved in key biological processes, most notably the DNA Damage Response (DDR) and cilium assembly and function. NEK1 kinase activity is regulated in response to genotoxic stress, where it facilitates the repair of double-strand breaks alongside proteins like ATM and ATR. Simultaneously, it localizes to the basal body of the primary cilium, governing ciliary structure and trafficking. The paramount importance of NEK1 is highlighted by its strong genetic association with Amyotrophic Lateral Sclerosis (ALS); loss-of-function mutations in NEK1 are recognized as one of the most common genetic causes of familial and sporadic ALS. Furthermore, biallelic mutations in NEK1 are responsible for the severe ciliopathy known as short-rib thoracic dysplasia, underscoring its vital role in skeletal development. Thus, NEK1 represents a crucial molecule at the crossroads of genome integrity, ciliary function, and human neurodegenerative and developmental diseases.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag25970 Product name: Recombinant human NEK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 557-740 aa of BC114491 Sequence: KRKEAYEREKKVWEEHLVAKGVKSSDVSPPLGQHETGGSPSKQQMRSVISVTSALKEVGVDSSLTDTRETSEEMQKTNNAISSKREILRRLNENLKAQEDEKGKQNLSDTFEINVHEDAKEHEKEKSVSSDRKKWEAGGQLVIPLDELTLDTSFSTTERHTVGEVIKLGPNGSPRRAWGKSPTD Predict reactive species\nFull Name: NIMA (never in mitosis gene a)-related kinase 1\nCalculated Molecular Weight: 1258 aa, 143 kDa\nObserved Molecular Weight: 170-180 kDa\nGenBank Accession Number: BC114491\nGene Symbol: NEK1\nGene ID (NCBI): 4750\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q96PY6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888789508265,"sku":"86224-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86224-2-rr","provider":"Iright","version":"1.0","type":"link"}