{"product_id":"proteintech-86261-1-rr","title":"Proteintech, 86261-1-RR, CXCL3\/GRO Gamma Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CXCL3\/GRO Gamma (86261-1-RR) by Proteintech is a Recombinant antibody targeting CXCL3\/GRO Gamma in WB, ELISA applications with reactivity to human, mouse, rat samples\n86261-1-RR targets CXCL3\/GRO Gamma in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: RAW 264.7 cells, A549 cells,  rat lung tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCXC chemokine ligand 3 (CXCL3) is a member of CXC-type chemokine family that is identified as a major regulator in immune and inflammation responses. CXCL3 is broadly expressed in various human tumor types, and it is also known to play a critical role in mediating tumor development and progression.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2982 Product name: recombinant human CXCL3 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 35-107 aa of NM_002090.3 Sequence: ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN Predict reactive species\nFull Name: chemokine (C-X-C motif) ligand 3\nCalculated Molecular Weight: 11 kDa\nObserved Molecular Weight: 11 kDa\nGenBank Accession Number: NM_002090.3\nGene Symbol: CXCL3\nGene ID (NCBI): 2921\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P19876\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888731345065,"sku":"86261-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86261-1-rr","provider":"Iright","version":"1.0","type":"link"}