{"product_id":"proteintech-86265-3-rr","title":"Proteintech, 86265-3-RR, CSRP1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CSRP1 (86265-3-RR) by Proteintech is a Recombinant antibody targeting CSRP1 in WB, ELISA applications with reactivity to human, mouse samples\n86265-3-RR targets CSRP1 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, PC-3 cells,  Neuro-2a cells,  C2C12 cells,  mouse uterus tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCSRP1 (Cysteine and glycine-rich protein 1), designated initially as CRP1, constitutes a cysteine-rich protein derived from placental sources and exhibits a response profile analogous to c-myc. CSRP1 has been recognized as a tumor suppressor in several types of cancers including colorectal cancer, and cholangiocarcinoma (PMID: 37113556). Abnormal expression of CSRP1 was reported within several malignancies such as prostate cancer and acute myeloid leukemia (PMID: 38813484, 40198006).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag4236 Product name: Recombinant human CSRP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-193 aa of BC032493 Sequence: MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE Predict reactive species\nFull Name: cysteine and glycine-rich protein 1\nCalculated Molecular Weight: 193 aa, 21 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC032493\nGene Symbol: CSRP1\nGene ID (NCBI): 1465\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P21291\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888730230953,"sku":"86265-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86265-3-rr","provider":"Iright","version":"1.0","type":"link"}