{"product_id":"proteintech-86266-1-rr","title":"Proteintech, 86266-1-RR, C19orf59 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe C19orf59 (86266-1-RR) by Proteintech is a Recombinant antibody targeting C19orf59 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n86266-1-RR targets C19orf59 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells\nPositive IF\/ICC detected in: THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe MCEMP1 gene contains seven exons and was mapped to human chromosome 19p13.3. The epitope-tagged MCEMP1 has been expressed in mammalian cells and found to be localized to the cellular membrane with its C-terminus extending to the outside of the membrane and N-terminus into the cytoplasmic compartment. An evidently increased expression of mast cell expression membrane protein 1 (MCEMP1) has been observed in stroke patients and its expression independently improved the discrimination of 1-month outcome, suggesting the functionality of peripheral blood expression of MCEMP1 as a biomarker for stroke prognosis . (PMID: 30883005, PMID: 31104315, PMID: 15953541)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag22616 Product name: Recombinant human C19orf59 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-187 aa of BC104798 Sequence: MEVEEIYKHQEVKMQAPAFRDKKQGVSAKNQGAHDPDYENITLAFKNQDHAKGGHSRPTSQVPAQCRPPSDSTQVPCWLYRAILSLYILLALAFVLCIILSAFIMVKNAEMSKELLGFKRELWNVSNSVQACEERQKRGWDSVQQSITMVRSKIDRLETTLAGIKNIDTKVQKILEVLQKMPQSSPQ Predict reactive species\nFull Name: chromosome 19 open reading frame 59\nObserved Molecular Weight: 22\/24 kDa\nGenBank Accession Number: BC104798\nGene Symbol: MCEMP1\nGene ID (NCBI): 199675\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8IX19\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888713683113,"sku":"86266-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86266-1-rr","provider":"Iright","version":"1.0","type":"link"}