{"product_id":"proteintech-86296-3-rr","title":"Proteintech, 86296-3-RR, CDK12\/CRKRS Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CDK12\/CRKRS (86296-3-RR) by Proteintech is a Recombinant antibody targeting CDK12\/CRKRS in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n86296-3-RR targets CDK12\/CRKRS in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, NIH\/3T3 cells,  HEK-293T cells,  Jurkat cells,  K-562 cells\nPositive IF\/ICC detected in: HeLa cells, NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCRKRS (Cdc2-related kinase, Arg\/Ser), also named as cyclin-dependent kinase 12 (CKD12), belongs to CDC2\/CDKX subfamily. CDK12 can form a heterodimeric complex with its activating partner, cyclin K, to regulate important cellular physiological processes that include transcriptional regulation, regulation of DNA damage repair genes such as BRCA1 and ATM, suppression of intronic polyadenylation, and susceptibility to PARP inhibitors (PMID: 30487607, 24240700, 31694772). CDK12 has 3 isoforms with the calculated molecular mass of 164\/163\/141 kDa, and the apparent molecular mass of 180-200 kDa due to some modifications (PMID 11683387, 22988298).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag25312 Product name: Recombinant human CRKRS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1300-1481 aa of BC150265 Sequence: EAEPPGHLPHEHQALRPMEYSTRPRPNRTYGNTDGPETGFSAIDTDERNSGPALTESLVQTLVKNRTFSGSLSHLGESSSYQGTGSVQFPGDQDLRFARVPLALHPVVGQPFLKAEGSSNSVVHAETKLQNYGELGPGTTGASSSGAGLHWGGPTQSSAYGKLYRGPTRVPPRGGRGRGVPY Predict reactive species\nFull Name: Cdc2-related kinase, arginine\/serine-rich\nCalculated Molecular Weight: 1490 aa, 164 kDa\nObserved Molecular Weight: 180-200 kDa\nGenBank Accession Number: BC150265\nGene Symbol: CDK12\nGene ID (NCBI): 51755\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NYV4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888724758697,"sku":"86296-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86296-3-rr","provider":"Iright","version":"1.0","type":"link"}