{"product_id":"proteintech-86335-3-rr","title":"Proteintech, 86335-3-RR, SNX1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SNX1 (86335-3-RR) by Proteintech is a Recombinant antibody targeting SNX1 in WB, ELISA applications with reactivity to human samples\n86335-3-RR targets SNX1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HEK-293T cells,  HeLa cells,  HepG2 cells,  Ramos cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSorting nexin 1 (SNX1, synonyms: SNX1A, MGC8664, HsT17379) is a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This endosomal protein regulates the cell-surface expression of epidermal growth factor receptor. SNX1 also has a role in sorting protease-activated receptor-1 from early endosomes to lysosomes. This protein may form oligomeric complexes with family members.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0499 Product name: Recombinant human SNX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 82-287 aa of BC000357 Sequence: DQEPQDLFADATVELSLDSTQNNQKKVLAKTLISLPPQEATNSSKPQPTYEELEEEEQEDQFDLTVGITDPEKIGDGMNAYVAYKVTTQTSLPLFRSKQFAVKRRFSDFLGLYEKLSEKHSQNGFIVPPPPEKSLIGMTKVKVGKEDSSSAEFLEKRRAALERYLQRIVNHPTMLQDPDVREFLEKEELPRAVGTQTLSGAGLLKM Predict reactive species\nFull Name: sorting nexin 1\nCalculated Molecular Weight: 59 kDa\nObserved Molecular Weight: 75 kDa\nGenBank Accession Number: BC000357\nGene Symbol: SNX1\nGene ID (NCBI): 6642\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q13596\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888825028777,"sku":"86335-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86335-3-rr","provider":"Iright","version":"1.0","type":"link"}