{"product_id":"proteintech-86336-1-rr","title":"Proteintech, 86336-1-RR, ZnT4 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ZnT4 (86336-1-RR) by Proteintech is a Recombinant antibody targeting ZnT4 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n86336-1-RR targets ZnT4 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, mouse brain tissue\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZnT4, also known as SLC30A4, belongs to the cation diffusion facilitator (CDF) transporter (TC 2.A.4) family and SLC30A subfamily. ZnT4 transports Zn into the trans-Golgi apparatus for lactose synthesis, and across the apical cell membrane for efflux from MECs into milk. ZnT4 is expressed in numerous tissues and is enriched in the prostate. ZnT4 encodes a protein with a molecular weight of 47 kDa (PMID: 26538236).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag3313 Product name: Recombinant human SLC30A4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-120 aa of BC026089 Sequence: MAGSGAWKRLKSMLRKDDAPLFLNDTSAFDFSDEAGDEGLSRFNKLRVVVADDGSEAPERPVNGAHPTLQADDDSLLDQDLPLTNSQLSLKVDSCDNCSKQREILKQRKVKARLTIAAVL Predict reactive species\nFull Name: solute carrier family 30 (zinc transporter), member 4\nCalculated Molecular Weight: 429 aa, 47 kDa\nObserved Molecular Weight: 47 kDa\nGenBank Accession Number: BC026089\nGene Symbol: ZNT4\nGene ID (NCBI): 7782\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O14863\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888845705385,"sku":"86336-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86336-1-rr","provider":"Iright","version":"1.0","type":"link"}