{"product_id":"proteintech-86413-1-rr","title":"Proteintech, 86413-1-RR, RFX4 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe RFX4 (86413-1-RR) by Proteintech is a Recombinant antibody targeting RFX4 in WB, ELISA applications with reactivity to human, mouse, rat samples\n86413-1-RR targets RFX4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-29 cells, mouse brain tissue,  rat brain tissue,  fetal human brain tissue,  mouse testis tissue,  rat testis tissue,  human testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRFX4, also named as NYD-SP10, contains one RFX-type winged-helix DNA-binding domain and belongs to the RFX family. It may activate transcription by interacting directly with the X-box. The protein is structurally related to regulatory factors X1, X2, X3, and X5. It has been shown to interact with itself as well as with regulatory factors X2 and X3, but it does not interact with regulatory factor X1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg4119 Product name: Recombinant Human RFX4 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 140-190 aa of BC030644 Sequence: YYDVMYSKKGAAWVSETGKKEVSKQTVAYSPRSKLGTLLPEFPNVKDLNLP Predict reactive species\nFull Name: regulatory factor X, 4 (influences HLA class II expression)\nCalculated Molecular Weight: 83 kDa\nObserved Molecular Weight: 84 kDa\nGenBank Accession Number: BC030644\nGene Symbol: RFX4\nGene ID (NCBI): 5992\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q33E94\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888814346409,"sku":"86413-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86413-1-rr","provider":"Iright","version":"1.0","type":"link"}