{"product_id":"proteintech-86470-1-rr","title":"Proteintech, 86470-1-RR, NDUFA1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NDUFA1 (86470-1-RR) by Proteintech is a Recombinant antibody targeting NDUFA1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n86470-1-RR targets NDUFA1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A-673 cells, SK-BR-3 cells,  PANC-1 cells,  Ramos cells,  HeLa cells,  mouse heart tissue,  rat heart tissue\nPositive IHC detected in: mouse heart tissue, rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNDUFA1, also known as NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1, it's part of the NADH dehydrogenase (ubiquinone) 1 alpha subcomplex. The NDUFA1 gene encoding the MWFE polypeptide is located on the X chromosome. The NDUFA1 gene product (MWFE protein) is essential for activity of complex I in mammalian mitochondria, and it is predicted to be a membrane protein (PMID: 10200266).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag7206 Product name: Recombinant human NDUFA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC000266 Sequence: MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID Predict reactive species\nFull Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa\nCalculated Molecular Weight: 7.5 kDa\nObserved Molecular Weight: 8 kDa\nGenBank Accession Number: BC000266\nGene Symbol: NDUFA1\nGene ID (NCBI): 4694\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O15239\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888789082281,"sku":"86470-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86470-1-rr","provider":"Iright","version":"1.0","type":"link"}