{"product_id":"proteintech-86511-3-rr","title":"Proteintech, 86511-3-RR, FABP3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe FABP3 (86511-3-RR) by Proteintech is a Recombinant antibody targeting FABP3 in WB, ELISA applications with reactivity to human, mouse, rat, pig samples\n86511-3-RR targets FABP3 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human skeletal muscle tissue, mouse skeletal muscle tissue,  human heart tissue,  mouse heart tissue,  rat heart tissue,  pig heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFABP3 (fatty-acid-binding protein 3), also known as heart-type FABP or mammary-derived growth inhibitor (MDGI), is a small 15-kDa cytoplasmic protein transporting fatty acids and other lipophilic substances from the cytoplasm to the nucleus. It is most ubiquitously expressed in heart and skeletal muscle.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag1069 Product name: Recombinant human FABP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-133 aa of BC007021 Sequence: MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA Predict reactive species\nFull Name: fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor)\nCalculated Molecular Weight: 15 kDa\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: BC007021\nGene Symbol: FABP3\nGene ID (NCBI): 2170\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P05413\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888743534761,"sku":"86511-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86511-3-rr","provider":"Iright","version":"1.0","type":"link"}