{"product_id":"proteintech-86534-2-rr","title":"Proteintech, 86534-2-RR, LOXL1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe LOXL1 (86534-2-RR) by Proteintech is a Recombinant antibody targeting LOXL1 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n86534-2-RR targets LOXL1 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, MG-63 cells,  PC-3 cells,  U-87 MG cells\nPositive IF\/ICC detected in: U-87 MG cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThree LOXL1 variants are seen: a band of 64 kDa matching the predicted full-length form lacking the secretory signal peptide, a band of 67 kDa presumed to be the full-length form with the signal peptide, and a band of 36 kDa matching the cleavage product.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag24293 Product name: Recombinant human LOXL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 283-366 aa of BC015090 Sequence: TPGFEQAYPDPGPEAAQAHGGDPRLGWYPPYANPPPEAYGPPRALEPPYLPVRSSDTPPPGGERNGAQQGRLSVGSVYRPNQNG Predict reactive species\nFull Name: lysyl oxidase-like 1\nCalculated Molecular Weight: 63 kDa\nObserved Molecular Weight: 60-63 kDa\nGenBank Accession Number: BC015090\nGene Symbol: LOXL1\nGene ID (NCBI): 4016\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q08397\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888776925353,"sku":"86534-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86534-2-rr","provider":"Iright","version":"1.0","type":"link"}