{"product_id":"proteintech-86541-2-rr","title":"Proteintech, 86541-2-RR, Shootin 1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Shootin 1 (86541-2-RR) by Proteintech is a Recombinant antibody targeting Shootin 1 in WB, ELISA applications with reactivity to human, mouse samples\n86541-2-RR targets Shootin 1 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SK-N-SH cells, SH-SY5Y cells,  HeLa cells,  Neuro-2a cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nShootin 1, also known as SHTN1, KIAA1598, contains 3 coiled-coil domains and a proline-rich region. Shootin 1 is involved in generating internal asymmetric signals required for neuronal during stages 2 and 3. Shootin 1 plays a role in cytoskeletal organization by regulating the subcellular localization of phosphoinositide 3-kinase (PI3K) activity at the axonal growth cone. SHTN1 produces 2 splice variants, a short variant, SHTN1S, that lacks exons 15 and 16, and a long variant, SHTN1L, that includes exons 1 through 17(PMID: 17030985, 30733148).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag18294 Product name: Recombinant human KIAA1598 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 834-1066 aa of BC022348 Sequence: TEEVTDLKRQAVEEMMDRIKKGVHLRPVNQTARPKTKPESSKGCESAVDELKGILGTLNKSTSSRSLKSLDPENSETELERILRRRKVTAEADSSSPTGILATSESKSMPVLGSVSSVTKTALNKKTLEAEFNSPSPPTPEPGEGPRKLEGCTSSKVTFQPPSSIGCRKKYIDGEKQAEPVVVLDPVSTHEPQTKDQVAEKDPTQHKEDEGEIQPENKEDSIENVRETDSSNC Predict reactive species\nFull Name: KIAA1598\nCalculated Molecular Weight: 72 kDa\nObserved Molecular Weight: 60-80 kDa\nGenBank Accession Number: BC022348\nGene Symbol: Shootin 1\nGene ID (NCBI): 57698\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: A0MZ66\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888821883049,"sku":"86541-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86541-2-rr","provider":"Iright","version":"1.0","type":"link"}