{"product_id":"proteintech-86615-3-rr","title":"Proteintech, 86615-3-RR, MASP1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe MASP1 (86615-3-RR) by Proteintech is a Recombinant antibody targeting MASP1 in WB, ELISA applications with reactivity to mouse samples\n86615-3-RR targets MASP1 in WB, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse serum\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMASP1, also known as CRARF, is a serine protease that functions as a component of the lectin pathway of complement activation. The complement pathway plays an essential role in the innate and adaptive immune response. The lectin pathway is triggered upon binding of mannan-binding lectin (MBL) and ficolins to sugar moieties, which leads to activation of the associated proteases MASP1 and MASP2. The observed molecular weight of 90 kDa is consistent with the values described in the literature (PMID: 24472859, 12396007).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg4420 Product name: Recombinant Mouse Masp1 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 300-445 aa of NM_008555.2 Sequence: RAAGNECPKLQPPVYGKIEPSQAVYSFKDQVLVSCDTGYKVLKDNEVMDTFQIECLKDGAWSNKIPTCKIVDCGAPAGLKHGLVTFSTRNNLTTYKSEIRYSCQQPYYKMLHNTTGVYTCSAHGTWTNEVLKRSLPTCLPVCGVPK Predict reactive species\nFull Name: mannan-binding lectin serine peptidase 1\nCalculated Molecular Weight: 80 kDa\nObserved Molecular Weight: 90 kDa\nGenBank Accession Number: NM_008555.2\nGene Symbol: Masp1\nGene ID (NCBI): 17174\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P98064-1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888780628137,"sku":"86615-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86615-3-rr","provider":"Iright","version":"1.0","type":"link"}