{"product_id":"proteintech-86630-3-rr","title":"Proteintech, 86630-3-RR, Importin Beta Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Importin Beta (86630-3-RR) by Proteintech is a Recombinant antibody targeting Importin Beta in WB, ELISA applications with reactivity to human, mouse, rat samples\n86630-3-RR targets Importin Beta in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A2780 cells, HeLa cells,  HT-1080 cells,  NIH\/3T3 cells,  C6 cells,  mouse brain tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nImportin beta1, also known karyopherin beta or KPNB1, is a nuclear transport receptor that plays a key role in the nuclear import process. Importin beta1 and importin alpha work in concert to transport cargo into the nucleus, functioning as an essential component of the classical nuclear localization signal (NLS) pathway. Elevated expression of importin beta1 has been found in cervical tumors. (22125623)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0122 Product name: Recombinant human KPNB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 409-612 aa of BC003572 Sequence: AMPTLIELMKDPSVVVRDTAAWTVGRICELLPEAAINDVYLAPLLQCLIEGLSAEPRVASNVCWAFSSLAEAAYEAADVADDQEEPATYCLSSSFELIVQKLLETTDRPDGHQNNLRSSAYESLMEIVKNSAKDCYPAVQKTTLVIMERLQQVLQMESHIQSTSDRIQFNDLQSLLCATLQNVLRKVQHQDALQISDVVMASLL Predict reactive species\nFull Name: karyopherin (importin) beta 1\nCalculated Molecular Weight: 97 kDa\nObserved Molecular Weight: 90-97 kDa\nGenBank Accession Number: BC003572\nGene Symbol: KPNB1\nGene ID (NCBI): 3837\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q14974\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888769847465,"sku":"86630-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86630-3-rr","provider":"Iright","version":"1.0","type":"link"}