{"product_id":"proteintech-86658-1-rr","title":"Proteintech, 86658-1-RR, Placental lactogen Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Placental lactogen (86658-1-RR) by Proteintech is a Recombinant antibody targeting Placental lactogen in WB, IHC, ELISA applications with reactivity to human samples\n86658-1-RR targets Placental lactogen in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:5000-1:20000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe human growth hormone (GH) locus is comprised by two GH (GH1 and GH2) genes and three chorionic somatomammotropin (CSH1, CSH2 and CSH-L) genes. Placental lactogens (CSH1, CSH2)  are produced in the mammalian placenta and are similar in structure and function to growth hormones. Together, placental lactogens and growth factors play an essential role to assure successful lactation after pregnancy. Placental lactogens also modify the metabolic state of the mother during pregnancy to supply energy to the fetus.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag9412 Product name: Recombinant human CSH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-217 aa of BC022044 Sequence: MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF Predict reactive species\nFull Name: chorionic somatomammotropin hormone 2\nCalculated Molecular Weight: 217 aa, 25 kDa\nObserved Molecular Weight: 20-25 kDa\nGenBank Accession Number: BC022044\nGene Symbol: CSH2\nGene ID (NCBI): 1443\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P01243\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888658305193,"sku":"86658-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86658-1-rr","provider":"Iright","version":"1.0","type":"link"}