{"product_id":"proteintech-86661-3-rr","title":"Proteintech, 86661-3-RR, DHTKD1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe DHTKD1 (86661-3-RR) by Proteintech is a Recombinant antibody targeting DHTKD1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n86661-3-RR targets DHTKD1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L02 cells, MCF-7 cells,  HepG2 cells,  mouse liver tissue,  mouse kidney tissue,  rat kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDHTKD1 (Dehydrogenase E1 And Transketolase Domain Containing 1), also named as 2-aminoadipic 2-oxoadipic aciduria protein, OADC-E1, OADH-E1, is a lesser-studied E1 enzyme among the family of 2-oxoacid dehydrogenases (PMID: 32695416). DHTKD1 was expressed ubiquitously in various tissues and was proposed to localize to the mitochondria (PMID: 23141294). DHTKD1 plays a critical role in energy production in mitochondria, suppression of DHTKD1 leads to impaired mitochondrial biogenesis and increased cell apoptosis (PMID: 24076469).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag26515 Product name: Recombinant human DHTKD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-197 aa of BC007955 Sequence: GYRPRKPESREPQGALERPPVDHGLARLVTVYCEHGHKAAKINPLFTGQALLENVPEIQALVQTLQGPFHTAGLLNMGKEEASLEEVLVYLNQIYCGQISIETSQLQSQDEKDWFAKRFEELQKETFTTEERKHLSKLMLESQEFDHFLATKFSTVKRYGGEGAES Predict reactive species\nFull Name: dehydrogenase E1 and transketolase domain containing 1\nCalculated Molecular Weight: 103 kDa\nObserved Molecular Weight: 103 kDa\nGenBank Accession Number: BC007955\nGene Symbol: DHTKD1\nGene ID (NCBI): 55526\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q96HY7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888735604905,"sku":"86661-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86661-3-rr","provider":"Iright","version":"1.0","type":"link"}