{"product_id":"proteintech-86714-3-rr","title":"Proteintech, 86714-3-RR, SOX9 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SOX9 (86714-3-RR) by Proteintech is a Recombinant antibody targeting SOX9 in WB, ELISA applications with reactivity to human samples\n86714-3-RR targets SOX9 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BxPC-3 cells, SW480 cells,  HCT 116 cells,  HT-29 cells,  NCCIT cells,  PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSOX9, also named as Transcription factor SOX-9, is a 509 amino acid protein. Sex-determining\nregion Y (SRY)-box 9 protein (SOX9) is a member of the SOX family of transcription factors (TFs) which are developmental regulators that possess high mobility group (HMG) box DNA binding and transactivation domains. It participates in a variety of functions, such as lineage restriction and terminal diferentiation, through precise temporal and spatial expression patterns that difer between particular cell types and tissues. SOX9 gene has been implicated in different types of cancer as an oncogene; however, it also may behave as a tumor suppressor. SOX9 can be ubiquitinated or SUMOylated to higher molecular weight (PMID: 24155239; 16307912; 16554309; 32070068)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag26274 Product name: Recombinant human SOX9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 306-405 aa of NM_000346 Sequence: MVPATHGQVTYTGSYGISSTAATPASAGHVWMSKQQAPPPPPQQPPQAPPAPQAPPQPQAAPPQQPAAPPQQPQAHTLTTLSSEPGQSQRTHIKTEQLSPS Predict reactive species\nFull Name: SRY (sex determining region Y)-box 9\nCalculated Molecular Weight: 56 kDa\nObserved Molecular Weight: 56 kDa\nGenBank Accession Number: NM_000346\nGene Symbol: SOX9\nGene ID (NCBI): 6662\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P48436\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888825782441,"sku":"86714-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86714-3-rr","provider":"Iright","version":"1.0","type":"link"}