{"product_id":"proteintech-86722-1-rr","title":"Proteintech, 86722-1-RR, KPNA3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe KPNA3 (86722-1-RR) by Proteintech is a Recombinant antibody targeting KPNA3 in WB, ELISA applications with reactivity to human, mouse, rat samples\n86722-1-RR targets KPNA3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, LNCaP cells,  HeLa cells,  Caco-2 cells,  NIH\/3T3 cells,  PC-12 cells,  HSC-t6 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKPNA3, karyopherin subunit alpha 3, also known as SRP1 or IPOA4. It is expected to be located in cytoplasm and nucleus, the protein is ubiquitous and highly expressed in heart, skeletal muscle. The calculated molecular weight of KPNA3 is 57 kDa. Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin\/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag27755 Product name: Recombinant human KPNA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 322-453 aa of BC017355 Sequence: VLNCDVLSHFPNLLSHPKEKINKEAVWFLSNITAGNQQQVQAVIDAGLIPMIIHQLAKGDFGTQKEAAWAISNLTISGRKDQVEYLVQQNVIPPFCNLLSVKDSQVVQVVLDGLKNILIMAGDEASTIAEII Predict reactive species\nFull Name: karyopherin alpha 3 (importin alpha 4)\nCalculated Molecular Weight: 58 kDa\nObserved Molecular Weight: 57-60 kDa\nGenBank Accession Number: BC017355\nGene Symbol: KPNA3\nGene ID (NCBI): 3839\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O00505\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888775319721,"sku":"86722-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86722-1-rr","provider":"Iright","version":"1.0","type":"link"}