{"product_id":"proteintech-86783-3-rr","title":"Proteintech, 86783-3-RR, COX6B1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe COX6B1 (86783-3-RR) by Proteintech is a Recombinant antibody targeting COX6B1 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n86783-3-RR targets COX6B1 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, Caco-2 cells,  HeLa cells,  human heart tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCOX6B1 (Cytochrome c oxidase subunit 6B1) is also named as COX6B and belongs to the cytochrome c oxidase subunit 6B family. It connects the two COX monomers into the physiological dimeric form. Defects in COX6B1 are a cause of mitochondrial complex IV deficiency (MT-C4D).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag1984 Product name: Recombinant human COX6B1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-86 aa of BC001015 Sequence: MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI Predict reactive species\nFull Name: cytochrome c oxidase subunit Vib polypeptide 1 (ubiquitous)\nCalculated Molecular Weight: 80 aa, 10 kDa\nObserved Molecular Weight: 10-13 kDa\nGenBank Accession Number: BC001015\nGene Symbol: COX6B1\nGene ID (NCBI): 1340\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P14854\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888729018537,"sku":"86783-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86783-3-rr","provider":"Iright","version":"1.0","type":"link"}