{"product_id":"proteintech-86803-1-rr","title":"Proteintech, 86803-1-RR, MPZL3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe MPZL3 (86803-1-RR) by Proteintech is a Recombinant antibody targeting MPZL3 in WB, ELISA applications with reactivity to mouse, rat samples\n86803-1-RR targets MPZL3 in WB, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, rat liver tissue,  mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMPZL3(Myelin Protein Zero Like 3) is a transmembrane protein belonging to the myelin protein zero (MPZ) gene family. It acts upstream of or within extracellular matrix organization and hair cycle. Predicted to be located in membrane. Predicted to be active in plasma membrane. Human ortholog(s) of this gene implicated in lung cancer. Orthologous to human MPZL3 (myelin protein zero like 3).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg6821 Product name: Recombinant mouse MPZL3 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 33-158 aa of NM_001093749.2 Sequence: LEISADAHVRGYVGEKIKLKCTFKSSSDVTDKLTIDWTYRPPSSSRTESIFHYQSFQYPTTAGTFRDRISWAGNVYKGDASISISNPTLKDNGTFSCAVKNPPDVYHNIPLTELTVTERGFGTMLSS Predict reactive species\nFull Name: myelin protein zero-like 3\nCalculated Molecular Weight: 26 kDa\nObserved Molecular Weight: 70 kDa, 28 kDa\nGenBank Accession Number: NM_001093749.2\nGene Symbol: Mpzl3\nGene ID (NCBI): 319742\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q3V3F6-1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888785248425,"sku":"86803-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86803-1-rr","provider":"Iright","version":"1.0","type":"link"}