{"product_id":"proteintech-86808-1-rr","title":"Proteintech, 86808-1-RR, TRAIP Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TRAIP (86808-1-RR) by Proteintech is a Recombinant antibody targeting TRAIP in WB, ELISA applications with reactivity to human samples\n86808-1-RR targets TRAIP in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nE3 ubiquitin-protein ligase TRAIP (TRAIP) is also named RING finger protein 206 (RNF206) and TRAF-interacting protein (TRIP). TRAIP, an E3 ligase containing a RING domain, has emerged as a significant contributor to maintaining genome integrity and TRAIP inhibits proliferation and migration of BLCA cells (PMID: 38123820). TRAIP helps replisomes overcome DNA interstrand crosslinks and DNA-protein crosslinks, whereas in mitosis it triggers disassembly of all replisomes that remain on chromatin (PMID: 33317933, PMID: 30842657).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0491 Product name: Recombinant human TRAIP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-204 aa of BC000310 Sequence: MPIRALCTICSDFFDHSRDVAAIHCGHTFHLQCLIQWFETAPSRTCPQCRIQVGKRTIINKLFFDLAQEEENVLDAEFLKNELDNVRAQLSQKDKEKRDSQVIIDTLRDTLEERNATVVSLQQALGKAEMLCSTLKKQMKYLEQQQDETKQAQEEARRLRSKMKTMEQIELLLQSQRPEVEEMIRDMGVGQSAVEQLAVYCVSL Predict reactive species\nFull Name: TRAF interacting protein\nCalculated Molecular Weight: 53 kDa\nObserved Molecular Weight: 53 kDa\nGenBank Accession Number: BC000310\nGene Symbol: TRAIP\nGene ID (NCBI): 10293\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9BWF2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888835481769,"sku":"86808-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86808-1-rr","provider":"Iright","version":"1.0","type":"link"}