{"product_id":"proteintech-86818-2-rr","title":"Proteintech, 86818-2-RR, COX6C Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe COX6C (86818-2-RR) by Proteintech is a Recombinant antibody targeting COX6C in WB, ELISA applications with reactivity to human, mouse, rat samples\n86818-2-RR targets COX6C in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, mouse heart tissue,  A-673 cells,  MCF-7 cells,  SW480 cells,  rat heart tissue,  human heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCytochrome c oxidase (COX) is the terminal oxidase in the respiratory chain in human and other mammalian cells. The enzyme is composed of 13 different subunits. COX6C(Cytochrome c oxidase subunit 6C) is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag1982 Product name: Recombinant human COX6C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-75 aa of BC000187 Sequence: MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK Predict reactive species\nFull Name: cytochrome c oxidase subunit VIc\nCalculated Molecular Weight: 75 aa, 9 kDa\nObserved Molecular Weight: 9 kDa\nGenBank Accession Number: BC000187\nGene Symbol: COX6C\nGene ID (NCBI): 1345\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P09669\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888607678633,"sku":"86818-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86818-2-rr","provider":"Iright","version":"1.0","type":"link"}