{"product_id":"proteintech-86876-1-rr","title":"Proteintech, 86876-1-RR, ECHDC2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ECHDC2 (86876-1-RR) by Proteintech is a Recombinant antibody targeting ECHDC2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n86876-1-RR targets ECHDC2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, rat liver tissue,  mouse heart tissue,  rat heart tissue,  human heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag23510 Product name: Recombinant human ECHDC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 37-90 aa of BC044574 Sequence: GPDQGITEILMNRPSARNALGNVFVSELLETLAQLREDRQVRVLLFRSGVKGVF Predict reactive species\nFull Name: enoyl Coenzyme A hydratase domain containing 2\nObserved Molecular Weight: 29-31 kDa\nGenBank Accession Number: BC044574\nGene Symbol: ECHDC2\nGene ID (NCBI): 55268\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q86YB7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888738881705,"sku":"86876-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86876-1-rr","provider":"Iright","version":"1.0","type":"link"}