{"product_id":"proteintech-86877-1-rr","title":"Proteintech, 86877-1-RR, GLYR1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GLYR1 (86877-1-RR) by Proteintech is a Recombinant antibody targeting GLYR1 in WB, IF\/ICC, ELISA applications with reactivity to human, rat samples\n86877-1-RR targets GLYR1 in WB, IF\/ICC, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  HepG2 cells,  Jurkat cells,  K-562 cells,  HSC-T6 cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGlyR1 (glyoxylate\/successful semi-Aldehyde Reductase 1) is a plant-specific NADPH- dependent reductase, which mainly locates in cytoplasm. It was originally regarded as \"glyoxal\/succinate semialdehyde reductase\", which can reduce glyoxylate, an intermediate product of photorespiration, to glycolate, and also reduce succinate semialdehyde produced by GABA metabolism to γ-hydroxybutyric acid, thus eliminating active aldehydes and alleviating oxidative damage caused by abiotic stress. In invasive breast cancer cells, GLYR1 was detected to \"flip\" from the nucleus to the cell membrane (ecto-GLYR1) and became a new tumor-specific antigen. Humanized antibody and CAR-NK\/CAR-T systems have been established for the membrane epitope, and will soon enter the clinical safety assessment. This means that GLYR1 itself can also be used as a \"membrane target antigen\" for precise tumor treatment.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag6637 Product name: Recombinant human N-PAC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 133-484 aa of BC064940 Sequence: WQPTASEPVKDADPHFHHFLLSQTEKPAVCYQAITKKLKICEEETGSTSIQAADSTAVNGSITPTDKKIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQLASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAANEVYKRAKALDQSDNDMSAVYRAYIH Predict reactive species\nFull Name: cytokine-like nuclear factor n-pac\nCalculated Molecular Weight: 61 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC064940\nGene Symbol: N-PAC\nGene ID (NCBI): 84656\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q49A26\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888756641961,"sku":"86877-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86877-1-rr","provider":"Iright","version":"1.0","type":"link"}