{"product_id":"proteintech-86886-1-rr","title":"Proteintech, 86886-1-RR, DcR1\/TNFRSF10C Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe DcR1\/TNFRSF10C (86886-1-RR) by Proteintech is a Recombinant antibody targeting DcR1\/TNFRSF10C in WB, ELISA applications with reactivity to human samples\n86886-1-RR targets DcR1\/TNFRSF10C in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: JAR cells, human placenta tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDecoy receptor 1 (DcR1), also known as TNFRSF10C, CD263, TRAIL-R3, or TRID, is a member of the TNF-receptor superfamily. DcR1 is a receptor for the cytotoxic ligand TRAIL. In contrast to DR4\/TRAIL-R1 and DR5\/TRAIL-R2, DcR1 is a glycosylphosphatidylinositol (GPI)-linked membrane molecule that lacks a cytoplasmic region, including the death domain (PMID: 9314565; 9242611). DcR1 is not capable of inducing apoptosis and is thought to function as an antagonistic receptor that protects cells from TRAIL-induced apoptosis (PMID: 9242610). The apparent molecular weight of DcR1 is larger than the calculated molecular weight of 27 kDa, suggesting the presence of extensive post-translational modifications and\/or unusual structural motifs (PMID: 9373179).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg4677 Product name: recombinant human TRAIL R3\/TNFRSF10C protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 26-235 aa of NM_003841.5 Sequence: ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMITSPGTP Predict reactive species\nFull Name: tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain\nCalculated Molecular Weight: 27 kDa\nObserved Molecular Weight: 60-75 kDa\nGenBank Accession Number: NM_003841.5\nGene Symbol: DcR1\nGene ID (NCBI): 8794\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O14798\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888610070697,"sku":"86886-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86886-1-rr","provider":"Iright","version":"1.0","type":"link"}