{"product_id":"proteintech-86923-1-rr","title":"Proteintech, 86923-1-RR, GM-CSF Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe GM-CSF (86923-1-RR) by Proteintech is a Recombinant antibody targeting GM-CSF in WB, ELISA applications with reactivity to rat samples\n86923-1-RR targets GM-CSF in WB, ELISA applications and shows reactivity with rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Transfected with Rat GM-CSF\/CSF2 HEK-293T cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGm-csf, also known as Csf2, is a monomeric glycoprotein secreted by macrophages, T cells, mast cells, NK cells, endothelial cells and fibroblasts that functions as a cytokine. Gm-csf was first characterized as a hematopoietic growth factor that stimulates the proliferation of myeloid cells from bone-marrow progenitors. Gm-csf is now recognized as an important activating and differentiation factor for immune cells, and is essential for a wide range of biological processes in both innate and adaptive immunity. Gm-csf has been shown to protect against pulmonary infection and intestinal inflammation, and it is necessary for normal pulmonary and colon homeostasis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3202 Product name: Recombinant Rat GM-CSF protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 18-144 aa of NM_053852.1 Sequence: APTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK Predict reactive species\nFull Name: colony stimulating factor 2 (granulocyte-macrophage)\nCalculated Molecular Weight: 17 kDa\nGenBank Accession Number: NM_053852.1\nGene Symbol: Csf2\nGene ID (NCBI): 116630\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P48750\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888756707497,"sku":"86923-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86923-1-rr","provider":"Iright","version":"1.0","type":"link"}