{"product_id":"proteintech-86931-1-rr","title":"Proteintech, 86931-1-RR, MLKL Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe MLKL (86931-1-RR) by Proteintech is a Recombinant antibody targeting MLKL in WB, IF\/ICC, ELISA applications with reactivity to mouse samples\n86931-1-RR targets MLKL in WB, IF\/ICC, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L-929 cells, 4T1 cells\nPositive IF\/ICC detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMixed lineage kinase domain like pseudokinase (MLKL), belongs to the protein kinase superfamily, has two MW of 54 and 30 kDa. MLKL plays a critical role in tumor necrosis factor (TNF)-induced necroptosis, a programmed cell death process, via interaction with receptor-interacting protein 3 (RIP3), which is a key signaling molecule in necroptosis pathway. High levels of this protein and RIP3 are associated with inflammatory bowel disease in children.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag32514 Product name: Recombinant mouse Mlkl protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of NM_001310613 Sequence: MDKLGQIIKLGQLIYEQCEKMKYCRKQCQRLGNRVHGLLQPLQRLQAQGKKNLPDDITAALGRFDEVLKEANQQIEKFSKKSHIWKFVSVGNDKILFHEVNEKLRDVWEELLLLLQVYHWNTVSDVSQPASWQQEDRQDAEEDGNENMKVILMQLQISVEEINKTLKQCSLKPTQEIPQDLQIKEIPKEHLGPPWTKLKT Predict reactive species\nFull Name: mixed lineage kinase domain-like\nCalculated Molecular Weight: 54kd\nObserved Molecular Weight: 54 kDa\nGenBank Accession Number: NM_001310613\nGene Symbol: Mlkl\nGene ID (NCBI): 74568\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9D2Y4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888783478953,"sku":"86931-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86931-1-rr","provider":"Iright","version":"1.0","type":"link"}