{"product_id":"proteintech-86957-1-rr","title":"Proteintech, 86957-1-RR, CYP46A1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CYP46A1 (86957-1-RR) by Proteintech is a Recombinant antibody targeting CYP46A1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n86957-1-RR targets CYP46A1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1500-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCytochrome P450 46A1 (CYP46A1), also named as CYP46, P450 46A1, CH24H and Cholesterol 24-hydroxylase, belongs to the cytochrome P450 family. CYP46A1 is a central nervous system-specific enzyme, and can freely cross the blood-brain barrier and be degraded in the liver. It is involved in the turnover of cholesterol. It converts cholesterol into 24S-hydroxycholesterol and, to a lesser extent, 25-hydroxycholesterol. CYP46A1 is significantly upregulated in hepatic lymphomyeloid cells compared with ESCs.(PMID:20039312)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag16786 Product name: Recombinant human CYP46A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 201-500 aa of BC022539 Sequence: TSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRKQLREVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQILKAEEGAQDDEGLLDNFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVIGSKRYLDFEDLGRLQYLSQVLKESLRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQRFGLQEQATLKPLDPVLCTLRPRGWQPAPPPPPC Predict reactive species\nFull Name: cytochrome P450, family 46, subfamily A, polypeptide 1\nCalculated Molecular Weight: 500 aa, 57 kDa\nObserved Molecular Weight: 57 kDa\nGenBank Accession Number: BC022539\nGene Symbol: CYP46A1\nGene ID (NCBI): 10858\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9Y6A2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888732721321,"sku":"86957-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86957-1-rr","provider":"Iright","version":"1.0","type":"link"}