{"product_id":"proteintech-86979-1-rr","title":"Proteintech, 86979-1-RR, ID3 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ID3 (86979-1-RR) by Proteintech is a Recombinant antibody targeting ID3 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n86979-1-RR targets ID3 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A549 cells,  Ramos cells,  Jurkat cells,  NIH\/3T3 cells,  HSC-T6 cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe helix-loop-helix (HLH) family of transcription factors plays a central role in the regulation of cell growth, differentiation and tumourigenesis. Members of the Id (inhibitor of DNA binding) class of these nuclear proteins are able to heterodimerise with and thereby antagonise the functions of other transcription factors of this family. Inhibitor of DNA binding 3, dominant negative helix-loop-helix protein (ID3, synonym: HEIR-1) is a member of the ID family of HLH proteins, which lacks a basic DNA-binding domain and inhibits transcription through formation of nonfunctional dimers that are incapable of binding to DNA.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0588 Product name: Recombinant human ID3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC003107 Sequence: MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELAPELVISNDKRSFCH Predict reactive species\nFull Name: inhibitor of DNA binding 3, dominant negative helix-loop-helix protein\nCalculated Molecular Weight: 119 aa, 13 kDa\nObserved Molecular Weight: 13-15 kDa\nGenBank Accession Number: BC003107\nGene Symbol: ID3\nGene ID (NCBI): 3399\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q02535\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888765489321,"sku":"86979-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-86979-1-rr","provider":"Iright","version":"1.0","type":"link"}