{"product_id":"proteintech-87082-1-rr","title":"Proteintech, 87082-1-RR, PTPMT1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PTPMT1 (87082-1-RR) by Proteintech is a Recombinant antibody targeting PTPMT1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n87082-1-RR targets PTPMT1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, PANC-1 cells,  HEK-293 cells,  HepG2 cells,  HuH-7 cells,  mouse pancreas tissue,  rat pancreas tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProtein Tyrosine Phosphatase localized to the Mitochondrial 1 (PTPMT1) is a highly conserved, dual-specific phosphatase that resides on the matrix-facing side of the inner mitochondrial membrane (IMM). PTPMT1 is a mitochondrial phosphatase and a vital regulator of mitochondrial activities. Current work points to roles for PTPMT1 in the regulation of mitochondrial respiration, dynamics, and ultrastructure through the modulation of pyruvate importation, the tuning of TCA cycle activity, and the synthesis of cardiolipin. PTPMT1 is highly expressed in pancreatic b cells, whose mitochondria have the important function of coupling glucose metabolism to the secretion of insulin. (PMID: 16337125, PMID: 16061174, PMID: 33335799)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag2063 Product name: Recombinant human PTPMT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-201 aa of BC020242 Sequence: MAATALLEAGLARVLFYPTLLYTLFRGKVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPEEAVRAIAKIRSYIHIRPGQLDVLKEFHKQITARATKDGTFVISKT Predict reactive species\nFull Name: protein tyrosine phosphatase, mitochondrial 1\nCalculated Molecular Weight: 201 aa, 23 kDa\nObserved Molecular Weight: 16 kDa\nGenBank Accession Number: BC020242\nGene Symbol: PTPMT1\nGene ID (NCBI): 114971\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8WUK0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888811823273,"sku":"87082-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-87082-1-rr","provider":"Iright","version":"1.0","type":"link"}