{"product_id":"proteintech-87100-1-rr","title":"Proteintech, 87100-1-RR, Apolipoprotein CIII Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Apolipoprotein CIII (87100-1-RR) by Proteintech is a Recombinant antibody targeting Apolipoprotein CIII in WB, IF\/ICC, ELISA applications with reactivity to human samples\n87100-1-RR targets Apolipoprotein CIII in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma, human serum\nPositive IF\/ICC detected in: L02 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nApolipoprotein CIII (apoCIII) is the most abundant C-apolipoprotein in human and is found on very low density lipoproteins, chylomicrons, and high density lipoproteins (HDL) (PMID: 18408013). ApoCIII inhibits lipoprotein lipase as well as binding of lipoproteins to cell surface heparan sulfate proteoglycans and receptors (PMID: 26228667). ApoC-III has 3 actions that can impair plasma lipoprotein metabolism and lead to hypertriglyceridemia (PMID: 24941081).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3387 Product name: recombinant human APOC3 protein Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 21-99 aa of NM_000040 Sequence: SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA Predict reactive species\nFull Name: apolipoprotein C-III\nCalculated Molecular Weight: 11 kDa\nObserved Molecular Weight: 11 kDa\nGenBank Accession Number: NM_000040\nGene Symbol: Apolipoprotein CIII\nGene ID (NCBI): 345\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P02656\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888707719337,"sku":"87100-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-87100-1-rr","provider":"Iright","version":"1.0","type":"link"}