{"product_id":"proteintech-87247-1-rr","title":"Proteintech, 87247-1-RR, TEM1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TEM1 (87247-1-RR) by Proteintech is a Recombinant antibody targeting TEM1 in WB, ELISA applications with reactivity to human, mouse samples\n87247-1-RR targets TEM1 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HUVEC cells, COLO 205 cells,  A2780 cells,  U2OS cells,  Caco-2 cells,  NIH\/3T3 cells,  bEnd.3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTEM1 (Tumor endothelial marker 1), also named as CD248, Endosialin and CD164L1, is a C-type lectin-like domain (CTLD) containing type I transmembrane glycoprotein. It is now considered to be a highly selective marker for activated perivascular and stromal cells, detected in most cancers and at least some inflammatory disorders. CD248 plays a role in tumor angiogenesis. It is a potential diagnostic tool and therapeutic target of inflammatory and malignant diseases. Two isoforms of human TEM1 exist. The calculated molecular weights of the two isoforms are 81 kDa and 46 kDa, respectively. Native TEM1 can be glycosylated, and the glycosylated form has a larger apparent molecular weight than 81 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg4427 Product name: recombinant human CD248 protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 18-360 aa of BC051340 Sequence: QDPWAAEPRAACGPSSCYALFPRRRTFLEAWRACRELGGDLATPRTPEEAQRVDSLVGAGPASRLLWIGLQRQARQCQLQRPLRGFTWTTGDQDTAFTNWAQPASGGPCPAQRCVALEASGEHRWLEGSCTLAVDGYLCQFGFEGACPALQDEAGQAGPAVYTTPFHLVSTEFEWLPFGSVAAVQCQAGRGASLLCVKQPEGGVGWSRAGPLCLGTGCSPDNGGCEHECVEEVDGHVSCRCTEGFRLAADGRSCEDPCAQAPCEQQCEPGGPQGYSCHCRLGFRPAEDDPHRCVDTDECQIAGVCQQMCVNYVGGFECYCSEGHELEADGISCSPAGAMGAQA Predict reactive species\nFull Name: CD248 molecule, endosialin\nCalculated Molecular Weight: 757 aa, 81 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC051340\nGene Symbol: TEM1\nGene ID (NCBI): 57124\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9HCU0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888830369961,"sku":"87247-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-87247-1-rr","provider":"Iright","version":"1.0","type":"link"}