{"product_id":"proteintech-87253-1-rr","title":"Proteintech, 87253-1-RR, NEK7 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NEK7 (87253-1-RR) by Proteintech is a Recombinant antibody targeting NEK7 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n87253-1-RR targets NEK7 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells,  NIH\/3T3 cells,  C6 cells,  RAW 264.7 cells\nPositive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMammalian NIMA-related kinases (NEKs) represent a family of serine\/threonine kinases, named NEK1-NEK11, which are implicated in the control of several aspects of mitosis and are involved in non-mitotic functions (PMID: 33364979). NIMA-related kinase 7 (NEK7) is the smallest NIMA-related kinase (NEK) in mammals. NEK7 is identified as a highly conserved serine or threonine kinase, which is not only crucial for mitosis entry, cell cycle progression, cell division, and mitotic process, but also expressed in brain, heart, lung, liver, spleen, and other issues (PMID: 31787755).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag33629 Product name: Recombinant human NEK7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-36 aa of NM_133494 Sequence: MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRI Predict reactive species\nFull Name: NIMA (never in mitosis gene a)-related kinase 7\nCalculated Molecular Weight: 35\nObserved Molecular Weight: 32-35 kDa\nGenBank Accession Number: NM_133494\nGene Symbol: NEK7\nGene ID (NCBI): 140609\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8TDX7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888789573801,"sku":"87253-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-87253-1-rr","provider":"Iright","version":"1.0","type":"link"}