{"product_id":"proteintech-87271-4-rr","title":"Proteintech, 87271-4-RR, Caspase 1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Caspase 1 (87271-4-RR) by Proteintech is a Recombinant antibody targeting Caspase 1 in WB, ELISA applications with reactivity to mouse samples\n87271-4-RR targets Caspase 1 in WB, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, mouse skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCASP1(caspase-1) is also named as IL1BC, IL1BCE and belongs to the peptidase C14A family. It is a cysteine protease that regulates inflammatory processes through its capacity to process and activate the interleukin-1-beta (IL1B), IL18, and IL33 precursor proteins. The active caspase-1 can increase cellular membrane permeability and intracellular calcium levels, which facilitates lysosome exocytosis and release of host antimicrobial factors and microbial products (PMID:21804020). 87271-4-RR is designed for mouse caspase 1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34441 Product name: Recombinant mouse Casp1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 119-296 aa of BC008152 Sequence: DNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFK Predict reactive species\nFull Name: caspase 1\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC008152\nGene Symbol: Caspase 1\nGene ID (NCBI): 12362\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P29452\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888716435625,"sku":"87271-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-87271-4-rr","provider":"Iright","version":"1.0","type":"link"}