{"product_id":"proteintech-87382-2-rr","title":"Proteintech, 87382-2-RR, Integrin alpha 6 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Integrin alpha 6 (87382-2-RR) by Proteintech is a Recombinant antibody targeting Integrin alpha 6 in WB, ELISA applications with reactivity to mouse, rat samples\n87382-2-RR targets Integrin alpha 6 in WB, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, mouse lung tissue,  rat lung tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe integrins are a superfamily of cell adhesion receptors that bind to extracellular matrix ligands, cell-surface ligands, and soluble ligands (PMID: 17543136). They are transmembrane αβ heterodimers and at least 24 distinct integrin heterodimers are formed by the combination of 18 α and eight β known subunits (PMID: 17543136; 20029421). In addition to mediating cell adhesion, integrins also play important roles in modulating signal transduction pathways that control cellular responses including migration, proliferation, differentiation, and apoptosis (PMID:19118207). Integrin alpha 6 (ITGA6, also known as CD49f or VLA-6) is a 120-kDa single-pass type 1 transmembrane glycoprotein, which combines with the beta 1 subunit (ITGB1, CD29) or beta 4 subunit (ITGB4, CD104) to form heterodimeric laminin receptors (PMID: 1976638; 2351695). Integrin alpha 6 mediates cell-to-cell and cell-to-stroma adhesion. It has also been found in many different stem cell populations and is involved in homing and connecting stem cells to their niches and regulating self-renewal mechanisms in stem cells (PMID: 28494695).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg10470 Product name: Recombinant mouse ITA6 protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-Twin-Strep-Tag Domain: 465-1011 aa of Q61739-1 Sequence: RPVINILKTITVTPNRIDLRQKSMCGSPSGICLKVKACFEYTAKPSGYNPPISILGILEAEKERRKSGLSSRVQFRNQGSEPKYTQELTLNRQKQRACMEETLWLQENIRDKLRPIPITASVEIQEPSSRRRVNSLPEVLPILNSNEAKTVQTDVHFLKEGCGDDNVCNSNLKLEYKFGTREGNQDKFSYLPIQKGIPELVLKDQKDIALEITVTNSPSDPRNPRKDGDDAHEAKLIATFPDTLTYSAYRELRAFPEKQLSCVANQNGSQADCELGNPFKRNSSVTFYLILSTTEVTFDTTDLDINLKLETTSNQDNLAPITAKAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFRVINLGKPLKNLGTATLNIQWPKEISNGKWLLYLMKVESKGLEQIVCEPHNEINYLKLKESHNSRKKRELPEKQIDDSRKFSLFPERKYQTLNCSVNVRCVNIRCPLRGLDSKASLVLRSRLWNSTFLEEYSKLNYLDILLRASIDVTAAAQNIKLPHAGTQVRVTVFPSKTVAQYS Predict reactive species\nFull Name: integrin alpha 6\nObserved Molecular Weight: 120 kDa\nGenBank Accession Number: Q61739-1\nGene Symbol: Itga6\nGene ID (NCBI): 16403\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888771059881,"sku":"87382-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-87382-2-rr","provider":"Iright","version":"1.0","type":"link"}