{"product_id":"proteintech-87406-1-rr","title":"Proteintech, 87406-1-RR, TSPYL2\/CDA1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TSPYL2\/CDA1 (87406-1-RR) by Proteintech is a Recombinant antibody targeting TSPYL2\/CDA1 in WB, ELISA applications with reactivity to human samples\n87406-1-RR targets TSPYL2\/CDA1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  DU 145 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTSPYL2 (also known as CINAP, CDA1, TSPX or DENTT) is a new member of the nucleosome assembly protein superfamily. TSPYL2 binds histones and facilitates nucleosome assembly. TSPYL2 is expressed in various tissues, highly in the pituitary gland and moderately in the adrenals, brain, testis, and ovary. Immunohistochemical staining analysis for TSPYL2 showed differential cytoplasmic and nuclear staining patterns in several cell types. Downregulated expression of TSPYL2 has been observed in several tumors, which suggests its role as a tumor suppressor. Although it is predicted that TSPYL2 has a molecular mass of 79.43 kDa, it is found that mammalian TSPYL2 appears at a size of 120 kDa by western blot analysis. The abundant acidic amino acid regions in TSPYL2 may cause its aberrant migration. In addition, the TSPYL2 protein is unstable and sensitive to proteasomal degradation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag41206 Product name: Recombinant human TSPYL2,TSPX,NP79 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 344-693 aa of BC024270 Sequence: WHRGQEPQARRHGNQDASHSFFSWFSNHSLPEADRIAEIIKNDLWVNPLRYYLRERGSRIKRKKQEMKKRKTRGRCEVVIMEDAPDYYAVEDIFSEISDIDETIHDIKISDFMETTDYFETTDNEITDINENICDSENPDHNEVPNNETTDNNESADDHETTDNNESADDNNENPEDNNKNTDDNEENPNNNENTYGNNFFKGGFWGSHGNNQDSSDSDNEADEASDDEDNDGNEGDNEGSDDDGNEGDNEGSDDDDRDIEYYEKVIEDFDKDQADYEDVIEIISDESVEEEGIEEGIQQDEDIYEEGNYEEEGSEDVWEEGEDSDDSDLEDVLQVPNGWANPGKRGKTG Predict reactive species\nFull Name: TSPY-like 2\nCalculated Molecular Weight: 693 aa, 79 kDa\nObserved Molecular Weight: 120 kDa\nGenBank Accession Number: BC024270\nGene Symbol: CDA1\nGene ID (NCBI): 64061\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9H2G4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888837742761,"sku":"87406-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-87406-1-rr","provider":"Iright","version":"1.0","type":"link"}